Protein Info for PFLU_RS02110 in Pseudomonas fluorescens SBW25

Annotation: MMPL family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 770 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 251 to 270 (20 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 370 to 393 (24 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details amino acids 636 to 655 (20 residues), see Phobius details amino acids 662 to 680 (19 residues), see Phobius details amino acids 686 to 705 (20 residues), see Phobius details amino acids 715 to 736 (22 residues), see Phobius details amino acids 742 to 763 (22 residues), see Phobius details PF03176: MMPL" amino acids 185 to 425 (241 residues), 21.5 bits, see alignment E=5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0427)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBI4 at UniProt or InterPro

Protein Sequence (770 amino acids)

>PFLU_RS02110 MMPL family transporter (Pseudomonas fluorescens SBW25)
MPSERLLPRLFLILLVAVLALAGWQWRHGAPLSANLMELVPGNTPDALEQQAEQRMQEPL
NREMLVLVGHADRQQAVAVAQQLGERWQASGLFEKVQWNLQADLPALREQLLRGRLAMLS
AKDREQLVKQPDAFIQQRVQALFDPFTGFSLVPSQDDWLGLTGRIQNSQPQHGSVQLDIG
SGALIADADGKSWVLLRARTTGNAFDMTLPLHVADLLQVSREQASGQGAQLLAASGLLYA
ANGQQQATREITWVGGGATVGILLLLLLAFRRWRVLLAFVPVLVGMLFGAVACVALFGHM
HVMTLVLGSSLIGVAVDYPLHYLSKSWSLQPWRSWPALRLTLPGLSLSLATSCIGYLALA
WTPFPALTQIAVFSAAGLVGAYLSAVCLLPALLKGVELRPAQWPLRIAECLWLVRASLLK
RVPSPVLLALLLLFCAGGLWHLNSKNDIRQWIGAPPQLLQEAQAVARITGFQPTSQFFLV
RADNQQQLLERQAALGQRLDQLVNMDKLQGYLALNQLVSLPAEQQQLRDALNKLPEHWQP
LLDLGVPASALQAEVAQLQALPTEDIDSALVGPLAEPWRTLWLGPVDGGVAAMVSLQGLN
NPALLRVQALDLPGVQLVDRLGDLNRVFADTQISAAELKLMSCVLIVLLLILPFGFGGAL
RIVALPLLAALCSLASLGWLGQPLTLFSLFGLLLVTAISVDYAILMREQIGGPAVSLLGT
LLAALTTWLSFGLLAVSSTPAVSNFGLSVSLGLAFSFMLAPWAGQQKHAL