Protein Info for PFLU_RS02080 in Pseudomonas fluorescens SBW25

Annotation: 3-oxoacyl-ACP reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF01370: Epimerase" amino acids 5 to 74 (70 residues), 22.2 bits, see alignment E=1.7e-08 PF08659: KR" amino acids 5 to 158 (154 residues), 76.5 bits, see alignment E=5e-25 PF00106: adh_short" amino acids 5 to 194 (190 residues), 173.4 bits, see alignment E=7.9e-55 TIGR01831: putative 3-oxoacyl-(acyl-carrier-protein) reductase" amino acids 5 to 241 (237 residues), 394.8 bits, see alignment E=6e-123 PF13561: adh_short_C2" amino acids 11 to 241 (231 residues), 184.7 bits, see alignment E=4.5e-58

Best Hits

Swiss-Prot: 77% identical to FABG_AGGAC: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to pfs:PFLU0421)

Predicted SEED Role

"3-oxoacyl-[ACP] reductase (EC 1.1.1.100)" (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBH8 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PFLU_RS02080 3-oxoacyl-ACP reductase FabG (Pseudomonas fluorescens SBW25)
MTESVLVTGSSRGIGRAIALRLAQAGHDIVLHCRSGRADADAVQAEVEALGRQARVLQFD
VADRALCKEILEADVEQHGAYYGVVLNAGLTRDGAFPALSEDDWDVVMRTNLDGFYNVLH
PVMMPMIRRRAAGRIVCITSVSGLIGNRGQVNYSASKAGLIGAAKALAIELGKRKITVNC
VAPGLIDTAMLDENVPVEELMKMIPAQRMGTPEEVAGAVNFLMSAEAGYITRQVLAVNGG
LC