Protein Info for PFLU_RS01905 in Pseudomonas fluorescens SBW25

Annotation: ubiquinone biosynthesis regulatory protein kinase UbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 transmembrane" amino acids 24 to 41 (18 residues), see Phobius details amino acids 490 to 509 (20 residues), see Phobius details amino acids 515 to 532 (18 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 7 to 446 (440 residues), 580.5 bits, see alignment E=8.7e-179 PF03109: ABC1" amino acids 95 to 343 (249 residues), 266.2 bits, see alignment E=1.1e-83

Best Hits

Swiss-Prot: 100% identical to UBIB_PSEFS: Probable protein kinase UbiB (ubiB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 100% identity to pfs:PFLU0387)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K8U2 at UniProt or InterPro

Protein Sequence (534 amino acids)

>PFLU_RS01905 ubiquinone biosynthesis regulatory protein kinase UbiB (Pseudomonas fluorescens SBW25)
MKLLAVRRLFRIQRVVIRYRLDDLLFALPLPWFLLAVRYVLPWRWFPRKQLELSRGARLR
LALQDLGPIFIKFGQILSTRRDLLPEDIADELMLLQDRVPPFDSQQSMKLIEEQLGKKIS
EVFSRFDVDPLASASVAQVHAAQLKTGEEVVVKVIRPGLKPIIGQDLAWLFILARAAERF
SADARLLHPVDVVADYEKTIYDELDLLREAANASQLKRNFEGSPLLYVPQVYWDWCRPKV
LVMERIYGVQVTDLATLADQRTDMKMLAERGVEIFFTQVFRDSFFHADMHPGNIFVSTVN
PWSPQYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHIDSGWVPAETKLNEFE
AAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQLY
PDLDLWNTAQPFLERWMRERMSPKTVLGNLHSQMEQLPHLANMTRDLLERMSQPHAKDPA
PPWKKRKDDWFLRLLGAAHLVGGVMLAIGGPLNQLGHWPAGIMVAVGVYLIVRR