Protein Info for PFLU_RS01855 in Pseudomonas fluorescens SBW25

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 115 to 210 (96 residues), 91.3 bits, see alignment E=2.4e-30 PF00528: BPD_transp_1" amino acids 135 to 316 (182 residues), 81 bits, see alignment E=4.7e-27

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 100% identity to pfs:PFLU0377)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K819 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PFLU_RS01855 amino acid ABC transporter permease (Pseudomonas fluorescens SBW25)
MKQKKAQWPWHLLTVVVLVGLAGALYYATSLMSYEWRWNRVPQYFAYQAEESQRAADIST
VVELVRKGDVAEVTLRNDAGTEQKLTVADNSLQVARGDDVAEGDVVGVTRHWALGPLMWG
LWTTLWLSVVSGILGLAIGLATGLCRLSSNPTLRDLSTIYVELVRGTPLLVQIFIFYFFI
GTVLNLSREFAGIAALSLFTGAYVAEIVRAGVQSITRGQNEAARSLGLSASQSMRHVVLP
QAFKRVLPPLAGQFISLVKDTSLVSVIAITELLKSGREVITTSFSPFEILFCVAGLYLLI
NLPLSKMASRLERRLAQSD