Protein Info for PFLU_RS01660 in Pseudomonas fluorescens SBW25

Annotation: rhodanese-like domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details PF00581: Rhodanese" amino acids 40 to 129 (90 residues), 61.2 bits, see alignment E=5.6e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0338)

Predicted SEED Role

"FIG136845: Rhodanese-related sulfurtransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K6W0 at UniProt or InterPro

Protein Sequence (137 amino acids)

>PFLU_RS01660 rhodanese-like domain-containing protein (Pseudomonas fluorescens SBW25)
MVDHLIAFATAHYLLVGAFVILLALLIAHEMSRGGRSLSTSELTALVNKDEAVVVDIRPA
KDFATGHIVGALNIPQDKLIARLAELEKYKAKTIILVDAQGQHAGTHAREMLKAGFTAAK
LSGGISSWRGDNLPLVK