Protein Info for PFLU_RS01475 in Pseudomonas fluorescens SBW25

Annotation: UDP-forming cellulose synthase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 739 transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 413 to 457 (45 residues), see Phobius details amino acids 483 to 496 (14 residues), see Phobius details amino acids 525 to 545 (21 residues), see Phobius details amino acids 551 to 576 (26 residues), see Phobius details TIGR03030: cellulose synthase catalytic subunit (UDP-forming)" amino acids 31 to 718 (688 residues), 1014.9 bits, see alignment E=0 PF13641: Glyco_tranf_2_3" amino acids 161 to 386 (226 residues), 69.7 bits, see alignment E=1e-22 PF00535: Glycos_transf_2" amino acids 163 to 332 (170 residues), 97.2 bits, see alignment E=3.1e-31 PF13506: Glyco_transf_21" amino acids 222 to 385 (164 residues), 23.7 bits, see alignment E=9.2e-09 PF13632: Glyco_trans_2_3" amino acids 241 to 444 (204 residues), 70.8 bits, see alignment E=4.4e-23 PF03552: Cellulose_synt" amino acids 337 to 454 (118 residues), 33.3 bits, see alignment E=6.4e-12 PF07238: PilZ" amino acids 580 to 676 (97 residues), 56.7 bits, see alignment E=7.8e-19

Best Hits

Swiss-Prot: 100% identical to BCSA_PSEFS: Cellulose synthase catalytic subunit [UDP-forming] (bcsA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00694, cellulose synthase (UDP-forming) [EC: 2.4.1.12] (inferred from 100% identity to pfs:PFLU0301)

Predicted SEED Role

"Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)" (EC 2.4.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58931 at UniProt or InterPro

Protein Sequence (739 amino acids)

>PFLU_RS01475 UDP-forming cellulose synthase catalytic subunit (Pseudomonas fluorescens SBW25)
MTDTTSSTPFVEGRAEQRLNGAIARFNRWPSAPRTVLVVASCVLGAMLLLGIISAPLDLY
SQCLFAAVCFLAVLVLRKIPGRLAILALVVLSLVASLRYMFWRLTSTLGFETWVDMFFGY
GLVAAEFYALIVLIFGYVQTAWPLRRTPVWLKTEPEEWPTVDVFIPTYNEALSIVKLTIF
AAQAMDWPKDKLRVHVLDDGRRDDFREFCRKVGVNYIRRDNNFHAKAGNLNEALKVTDGE
YIALFDADHVPTRSFLQVSLGWFLKDPKLAMLQTPHFFFSPDPFEKNLDTFRAVPNEGEL
FYGLVQDGNDLWNATFFCGSCAVIRREPLLEIGGVAVETVTEDAHTALKLNRLGYNTAYL
AIPQAAGLATESLSRHINQRIRWARGMAQIFRTDNPLLGKGLKWGQRICYANAMLHFFYG
LPRLVFLTAPLAYLIFGAEIFHASALMIVAYVLPHLVHSSLTNSRIQGRFRHSFWNEVYE
TVLAWYILPPVLVALVNPKAGGFNVTDKGGIIDKQFFDWKLARPYLVLLAVNLIGLGFGI
HQLIWGDASTAVTVAINLTWTLYNLIITSAAVAVASEARQVRSEPRVSAKLPVSIICADG
RVLDGTTQDFSQNGFGLMLSDGHSITQGERVQLVLSRNGQDSLFDARVVFSKGAQIGAQF
EALSLRQQSELVRLTFSRADTWAASWGAGQPDTPLAALREVGSIGIGGLFTLGRATLHEL
RLALSRTPTKPLDTLMDKP