Protein Info for PFLU_RS01055 in Pseudomonas fluorescens SBW25

Annotation: energy transducer TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 52 to 70 (19 residues), see Phobius details PF03544: TonB_C" amino acids 192 to 270 (79 residues), 81.8 bits, see alignment E=2e-27 TIGR01352: TonB family C-terminal domain" amino acids 194 to 270 (77 residues), 83.3 bits, see alignment E=6.1e-28

Best Hits

Swiss-Prot: 70% identical to TONB2_PSEAE: Protein tonB2 (tonB2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 100% identity to pfs:PFLU0209)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCN0 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PFLU_RS01055 energy transducer TonB (Pseudomonas fluorescens SBW25)
MGNVQTAASAPEAQWRQAPSGELVDLGRPHRAPLGQLRTQQTPKRFSSRREGILLGLLVL
ALHGAVIYWVSQKPTPVLPIVPPEIPPMTIEFSQPAPPVVEPPPPVPPPPPPPVVEPPPP
VVDELAAKPAPPKPIPKPKPKPVPKPEPKPAPKPVEQAPTPPQPAPPAPAPAPPAPAPVT
PASANAAYLKNPAPEYPSLAQRRGWEGTVLLRVHVLASGKPGEIQVQKSSGRQQLDDAAL
TAVKRWSFVPAKQGDVAQDGWVSVPIDFKIH