Protein Info for PFLU_RS00015 in Pseudomonas fluorescens SBW25

Annotation: DNA replication/repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 359 (359 residues), 384.8 bits, see alignment E=2.2e-119 PF02463: SMC_N" amino acids 3 to 359 (357 residues), 139.3 bits, see alignment E=1.3e-44 PF13476: AAA_23" amino acids 10 to 45 (36 residues), 30 bits, see alignment 7.8e-11

Best Hits

Swiss-Prot: 100% identical to RECF_PSEFS: DNA replication and repair protein RecF (recF) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 100% identity to pfs:PFLU0003)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDU4 at UniProt or InterPro

Protein Sequence (367 amino acids)

>PFLU_RS00015 DNA replication/repair protein RecF (Pseudomonas fluorescens SBW25)
MSLSRVSVTAVRNLHPVTFSPSPRINILHGANGSGKTSVLEAIHLLGLARSFRSARLLPV
IQYEQLACTVFGQVELAEGGHSSLGISRDRGGEFQIRIDGQNARSAAQLAEILPLQLINP
DSFRLLEGAPKIRRQFLDWGVFHVEPRFMATWQRLQKALRQRNSWLRHGTLDAASQAAWD
RELCLASDEIDEYRRAYIKALKPVFEQTLSELLDLEGLTLSYYRGWDKERELSAVLATSL
QRDQQIGHTQAGPQRADLRLRLGAHNAADILSRGQQKLVVCALRIAQGHLVSQARRGQCI
YLVDDLPSELDEQHRRALCRLLEELRCQVFITCVDHELLREGWQTETPVALFHVEQGRIT
QTHDHRE