Protein Info for OLJFJH_18485 in Erwinia amylovora T8

Annotation: methylthioribulose 1-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00596: Aldolase_II
  • amino acids 9 to 195 (187 residues), 146.6 bits, E=4.1e-47
• TIGR03328: methylthioribulose-1-phosphate dehydratase
  • amino acids 10 to 199 (190 residues), 224.9 bits, E=3.2e-71

Best Hits

Swiss-Prot: 76% identical to MTNB_CROS8: Methylthioribulose-1-phosphate dehydratase (mtnB) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K08964, methylthioribulose-1-phosphate dehydratase [EC: 4.2.1.109] (inferred from 100% identity to eam:EAMY_0873)

Predicted SEED Role

"Methylthioribulose-1-phosphate dehydratase (EC 4.2.1.109)" in subsystem Methionine Salvage (EC 4.2.1.109)

MetaCyc Pathways

• L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• L-methionine salvage cycle II (plants) (9/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.109

Protein Sequence (204 amino acids)

>OLJFJH_18485 methylthioribulose 1-phosphate dehydratase (Erwinia amylovora T8)
MTQSSQLDQLVAACHWIGARGWSPATGGNMSLRQDEQTCLLSASGKDKGSLTPADFIQVE
IATNRVPSGRKPSAETALHTLIYRLFPDAGAVLHTHTVNSTVLSRVEQGAALALQGYEMQ
KTLAGQHSHLDCVAIALFDNDQDIDALAQRIERFAAVQPLRYGFLLRGHGLTCWGKDVNE
ARRHLEGLEFLFQCELQRRLLERP