Protein Info for OLJFJH_17380 in Erwinia amylovora T8

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 PF07715: Plug" amino acids 12 to 122 (111 residues), 75.6 bits, see alignment E=6.5e-25 PF00593: TonB_dep_Rec_b-barrel" amino acids 204 to 639 (436 residues), 189.3 bits, see alignment E=3.6e-59 PF14905: OMP_b-brl_3" amino acids 372 to 652 (281 residues), 50.6 bits, see alignment E=2.5e-17

Best Hits

Swiss-Prot: 63% identical to YNCD_ECOLI: Probable TonB-dependent receptor YncD (yncD) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to eam:EAMY_1080)

MetaCyc: 63% identical to pyrroloquinoline quinone outer membrane transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-629

Predicted SEED Role

"Probable tonB-dependent receptor yncD precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (676 amino acids)

>OLJFJH_17380 TonB-dependent siderophore receptor (Erwinia amylovora T8)
MVIKQRGGLSELDTPAAVSVVDGDDLRRASAQVNLSENLASVPGLQIQNRQNYAQDLQLS
VRGFGSRSMYGVRGVRLYVDGIPATMPDGQGQTSNIDINSLGKAEVLRGPYSALYGNASG
GVVNIDTLSGSQPATLEAGTYFGSFGSWRNSLKVSGATGDGSEKGDVNYTLSASRFTTHG
YRDHSGTQKDLGNGKLGVRVDDVSTLTLMFNSVSVDASDPGGLSAEEYLANPRQSPRGDT
FNTRKSLDQTQLGLRYQRAFSDSDRLTLTTWHGERHTTQYQSIPQPPQLKPAHSGGVIVL
ERKYQGIDTRWQHEGQLAAVPVTLTGGIDYETMTEHRQGFQNYSLVSGVATFGEKGAQRR
NEKNTLWNLDSYLQTSWRLTPKLTLDAGLRYSTVSFDSTDDYITAKNGDDSGSARYHRLL
PMGALNYAVSDAWNVYLSAGRGFETPTINELSYRSVNGSITGLNLGLKPASSDNIELGSK
TRIGYGLLTAALFQTDSDNELVADDNENGRSVYKNAGETRRRGLELGFDQQFASDWRVKL
AWTLLDARYRNETCNVKRICTPAGHRLPGIARNMAYASLQYAPESGWHAGADIRYMSNIQ
ANDANDAQAPSYTVASLNGGYRFNWNKWSLDLFSRVDNLFDRRYIGSVIVNEGNSRYLEP
APGRNWGGGATISYQF