Protein Info for OLJFJH_16485 in Erwinia amylovora T8

Annotation: Sulfatase maturation enzyme AslB radical SAM superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF04055: Radical_SAM" amino acids 17 to 166 (150 residues), 36.4 bits, see alignment E=3.2e-13

Best Hits

KEGG orthology group: K06871, (no description) (inferred from 100% identity to eam:EAMY_1265)

Predicted SEED Role

"GALNS arylsulfatase regulator (Fe-S oxidoreductase)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>OLJFJH_16485 Sulfatase maturation enzyme AslB  radical SAM superfamily (Erwinia amylovora T8)
MTLIKGEKIKHLEIILKVSERCNISCTYCYVFNMGNTLAADSHPTISLNNVIALRGFFER
STAENEIEVIQVDFHGGKPLMMKKDRFDQMCHILLQGDYGNSRIELALQTHGILVDEEWI
TLFEKYKVQASIPVDGLRHRNNRHRPDRTGESTYKGTINGLRLLQNA