Protein Info for OLJFJH_15615 in Erwinia amylovora T8

Annotation: flagellar hook assembly protein FlgD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF03963: FlgD" amino acids 8 to 77 (70 residues), 86.1 bits, see alignment E=2.2e-28 PF13861: FLgD_tudor" amino acids 87 to 220 (134 residues), 52.8 bits, see alignment E=5.4e-18 PF13860: FlgD_ig" amino acids 110 to 180 (71 residues), 81 bits, see alignment E=7.3e-27

Best Hits

Swiss-Prot: 64% identical to FLGD_ECOLI: Basal-body rod modification protein FlgD (flgD) from Escherichia coli (strain K12)

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 100% identity to eay:EAM_1441)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>OLJFJH_15615 flagellar hook assembly protein FlgD (Erwinia amylovora T8)
MSIAVGVNEKQAATTLKSSSSSSDSSAADLQNNFLTLLVTQLKNQDPTNPMDNAQLTTQL
AQINTLSGVEKLNTTLGSISGQITSGQSLQASTLIGHGVMVNGTQILAGSSTTTPFGVEL
AQASTSTTATITDASGKVVETIDLGAQTAGVHTFQWNGKASDGTTAADGKYTVAISASNG
SGQLVAQPLSYALVSGVSSNSGGAVLDLGTMGTTTLEKVRQII