Protein Info for OLJFJH_15610 in Erwinia amylovora T8

Annotation: flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 TIGR03506: flagellar hook-basal body protein" amino acids 1 to 384 (384 residues), 309.2 bits, see alignment E=2.9e-96 PF00460: Flg_bb_rod" amino acids 6 to 33 (28 residues), 29.6 bits, see alignment (E = 1.1e-10) PF22692: LlgE_F_G_D1" amino acids 76 to 142 (67 residues), 40 bits, see alignment E=7.4e-14 PF07559: FlgE_D2" amino acids 157 to 283 (127 residues), 68.9 bits, see alignment E=1.3e-22 PF06429: Flg_bbr_C" amino acids 357 to 401 (45 residues), 60.1 bits, see alignment 2.3e-20

Best Hits

Swiss-Prot: 65% identical to FLGE_SALTI: Flagellar hook protein FlgE (flgE) from Salmonella typhi

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to eam:EAMY_1456)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>OLJFJH_15610 flagellar hook protein FlgE (Erwinia amylovora T8)
MGFSQAVSGLNAASSNLDVIGNNISNSATAGFKSSTVAFADMFAGSKVGLGTKVASVVQD
FNDGTTTNTSRGLDVAISSAGFFRMADANGGVFYSRNGQFTLDQNRNIVNMQGLHLTGYP
ATGTPPAVQTGANPVALSVPATAMTAKATTTAAITANLNSTDAVKNYANLNINDTTTYNA
KSSMTTFDSLGNAHTVNLYFVKTADNNWTVHPVDASTGTAGADTNLVFNANGQLVTPNNG
QVSFTMGQLNGSNGPTTLNVNLTGSQQQNNGKSTFGNPTQDGYKPGELTSYQINDDGTLV
GTYSNEQTQLLGQIVLSNFANPEGLKSEGDNVWSSTAASGQALSGIAGTGNLGTLTAGAL
ESSNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR