Protein Info for OLJFJH_15605 in Erwinia amylovora T8

Annotation: flagellar biosynthesis protein FlgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 120 (117 residues), 110.3 bits, see alignment E=8.4e-36 PF00460: Flg_bb_rod" amino acids 5 to 35 (31 residues), 40.9 bits, see alignment 2.3e-14 PF22692: LlgE_F_G_D1" amino acids 81 to 145 (65 residues), 50.3 bits, see alignment E=3.2e-17 PF06429: Flg_bbr_C" amino acids 203 to 247 (45 residues), 61.2 bits, see alignment 8.2e-21

Best Hits

Swiss-Prot: 75% identical to FLGF_SALTY: Flagellar basal-body rod protein FlgF (flgF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 100% identity to eay:EAM_1443)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>OLJFJH_15605 flagellar biosynthesis protein FlgF (Erwinia amylovora T8)
MDHAIYTAMGAASQTLDQQAVTASNLANASTPGFRAQLNAARAVPVEGLSLPTRTLVTAS
TPGADMSQGALDYTERALDVAMQGDGWLAVQTADGSEAYTRNGNMQVSPTGQLSVQGNAV
MGDGGPIAIPQGAQITIAADGSITALNPGDAPNATVQLGKLKLVKAVGNELTRGDDGMFR
VSASAQAQRGATLPLDPTMKVMPGVLEGSNVKATQTMVDMIANARRFEMQMKVISSVDEN
EQKANQLLSIG