Protein Info for OLJFJH_13955 in Erwinia amylovora T8

Annotation: carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 PF00135: COesterase" amino acids 9 to 477 (469 residues), 322.6 bits, see alignment E=9e-100 PF20434: BD-FAE" amino acids 99 to 202 (104 residues), 31.9 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: K03927, carboxylesterase type B [EC: 3.1.1.1] (inferred from 100% identity to eay:EAM_1770)

Predicted SEED Role

"Putative esterase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>OLJFJH_13955 carboxylesterase (Erwinia amylovora T8)
MRNDQRLRIVTAEGILRGNEAEGVFVFKGIPYAAPPVGELRWKAPHPVKPWSGERDAGKW
GPACWQNRDDCMAMGGGDPGELSEDCLYLNVWTPDITPSRPLPVMVWIHGGAYTIGSGGL
TPYSGAPLAQRGAIVVTLNYRLGHFGFFAHPALDKEYPQGEEINNFALLDQIAALHWVQR
NIHAFGGNAHNVTLMGESAGARSVLSLFTSPLAQGLFHKGIVQSAYTLPDVPRAAALQKG
QKLAGHFNLPAATAAQLRDLPAEAFLPLDHSLSCGPVAISGDRVLPVPMLDVFTAGRQHP
LPLIIGSNSDEASVLEFFGVDAARSIAEMRKKHPLMLQMIKWLYRGVSNDAELGRRVARD
MSFTIMGYIVSRAQQRIAVPCWRYYFDYVSENSRDIYRHGTWHGNEIPYVLNTLGQFTAE
ETGRPFTPGDEEFAERVSEYWLNFAREATPGTHAISGEIDWPAWHSSTDQTLRFGCNGLA
DIAIEKRFMRHRMRVFRILMKALVQLSH