Protein Info for OLJFJH_12815 in Erwinia amylovora T8

Annotation: tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 6 to 319 (314 residues), 482 bits, E=2.9e-149
• PF08003: Methyltransf_9
  • amino acids 6 to 320 (315 residues), 538.6 bits, E=1.2e-165
• PF13489: Methyltransf_23
  • amino acids 118 to 268 (151 residues), 44 bits, E=6e-15
• PF13847: Methyltransf_31
  • amino acids 121 to 226 (106 residues), 32.9 bits, E=1.5e-11
• PF13649: Methyltransf_25
  • amino acids 124 to 213 (90 residues), 32.3 bits, E=4.1e-11
• PF08241: Methyltransf_11
  • amino acids 125 to 222 (98 residues), 32.7 bits, E=3e-11
• PF08242: Methyltransf_12
  • amino acids 125 to 219 (95 residues), 30.4 bits, E=1.7e-10

Best Hits

Swiss-Prot: 94% identical to CMOB_ERWT9: tRNA U34 carboxymethyltransferase (cmoB) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to eay:EAM_2012)

MetaCyc: 78% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (321 amino acids)

>OLJFJH_12815 tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB (Erwinia amylovora T8)
MDFANFYQLIAKSPLSHWLETLPAQLAAWQRESLHGHFKNWDRSVEYLPGLIPESLDLLH
GVTADSSQLSPRQREGIEKLLRNLMPWRKGPFSLYGVNIDTEWRSDWKWDRVLPHISSLA
GRTVLDVGCGSGYHLWRMLGAGAHLVVGIDPMQLFLCQFEAVRKLLGNDQRAHLLPLGIE
QLPDLKAFDTVFSMGVLYHRRSPLDHLCQLKNQLVSGGELVLETLVIDADDQQVLVPGER
YAQMRNIYFIPSAGALKNWLEKCGFVDVRIVDHSFTSTDEQRRTSWMTSESLAEFLDPDN
ATKTVEGYPAPLRAVLVATKP