Protein Info for OLJFJH_12350 in Erwinia amylovora T8

Annotation: D-amino-acid oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF01946: Thi4" amino acids 17 to 52 (36 residues), 26.6 bits, see alignment 1.5e-09 PF00890: FAD_binding_2" amino acids 19 to 223 (205 residues), 30.7 bits, see alignment E=8.7e-11 PF01266: DAO" amino acids 19 to 413 (395 residues), 249.1 bits, see alignment E=4.4e-77 PF01134: GIDA" amino acids 19 to 47 (29 residues), 28.6 bits, see alignment (E = 3.5e-10) PF07992: Pyr_redox_2" amino acids 19 to 49 (31 residues), 29.8 bits, see alignment (E = 1.9e-10) PF12831: FAD_oxidored" amino acids 19 to 67 (49 residues), 35.3 bits, see alignment 3.9e-12 PF13450: NAD_binding_8" amino acids 22 to 49 (28 residues), 30.8 bits, see alignment (E = 1.3e-10)

Best Hits

KEGG orthology group: None (inferred from 100% identity to eay:EAM_2108)

Predicted SEED Role

"oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>OLJFJH_12350 D-amino-acid oxidase (Erwinia amylovora T8)
MPAPIRYVQDSPYFPPESDVVVIGGGIAGTAAAYELAKKGVSVVLIEKGLVGGEQSSRNW
GWCRQQNRDERELPLIIYALQRWGELGAETGEELGFRRSGLVYATQNQQDMNAWEAWNTM
AQGYGMHSELLNAVRAKAMTPGSTSGWLGGVFSPTDGHAEPALAVPGLALAARRLGAKLF
QQCAVRGLDISGGKVSGVLTERGLIKTRRVICAGGAWTSMFCRRHGIDLPLANVIGTAFR
TAPLEQHIALPLYTPGFACRPQIDGSYTVAVSGRGRLEPGVQSLRYARQFYPTYRSRRKD
LTIAPGIGPFLRGPESLARWQMDGVSPFEQVRILDPRPDLALVEEGLRAMRNEFPQMAAL
RLEQAWGGMIDSTPDAVPVISGVGKLPGLIVSAGYSGHGFGIGPGAGRLAADLATDDSPV
VDPTPFRYERLIAGSGLDAPGMM