Protein Info for OLJFJH_10750 in Erwinia amylovora T8

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF00072: Response_reg" amino acids 8 to 119 (112 residues), 90.5 bits, see alignment E=1.6e-29 PF04545: Sigma70_r4" amino acids 147 to 192 (46 residues), 25.3 bits, see alignment 1.8e-09 PF08281: Sigma70_r4_2" amino acids 147 to 192 (46 residues), 28.8 bits, see alignment 1.5e-10 PF00196: GerE" amino acids 149 to 202 (54 residues), 79.6 bits, see alignment E=2.2e-26

Best Hits

KEGG orthology group: K07685, two-component system, NarL family, nitrate/nitrite response regulator NarP (inferred from 100% identity to eay:EAM_2413)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>OLJFJH_10750 DNA-binding response regulator (Erwinia amylovora T8)
MEAQKYSVLIVDDHPLLRRGLHQLLAMEPRFEVIAEAGDGEEALFKARQLLPHLILLDLK
MQGMSGLETLKALRSSGISSRVVVLTASALSRDFTALQQAGAEGYLLKDSEPEDLLAQII
EVAEGRVARSPCLQASGPVESWKCDPLATLTAREQEVLKEVASGLPNKQVAENLAISEQT
VKVHIRNVLRKLNVRSRVAATVLWLEFCR