Protein Info for OLJFJH_10360 in Erwinia amylovora T8

Annotation: Fe-S cluster assembly transcriptional regulator IscR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 TIGR02010: iron-sulfur cluster assembly transcription factor IscR" amino acids 1 to 134 (134 residues), 222.1 bits, see alignment E=1.9e-70 TIGR00738: Rrf2 family protein" amino acids 1 to 131 (131 residues), 157.6 bits, see alignment E=1.6e-50 PF02082: Rrf2" amino acids 3 to 132 (130 residues), 137 bits, see alignment E=2.3e-44

Best Hits

Swiss-Prot: 98% identical to ISCR_ERWT9: HTH-type transcriptional regulator IscR (iscR) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 99% identity to epy:EpC_10280)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>OLJFJH_10360 Fe-S cluster assembly transcriptional regulator IscR (Erwinia amylovora T8)
MRLTSKGRYAVTAMLDVALHSHEGPVPLADISERQGISLSYLEQLFSRLRKNGLVASVRG
PGGGYLLGKAADAIAVGAVITAVDESVDATKCQGKEGCQGGERCLTHVLWRDLSERISDF
LNNITLAELVNNQEILDVADRQNSNEIRRAPHGRKHDTIDVNLRA