Protein Info for OLJFJH_06475 in Erwinia amylovora T8

Annotation: HTH-type transcriptional regulator MetR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 223 to 239 (17 residues), see Phobius details PF00126: HTH_1" amino acids 4 to 63 (60 residues), 65.6 bits, see alignment E=3.1e-22 PF03466: LysR_substrate" amino acids 85 to 288 (204 residues), 155.6 bits, see alignment E=1.2e-49

Best Hits

Swiss-Prot: 84% identical to METR_SHIFL: HTH-type transcriptional regulator MetR (metR) from Shigella flexneri

KEGG orthology group: K03576, LysR family transcriptional regulator, regulator for metE and metH (inferred from 100% identity to eam:EAMY_0207)

Predicted SEED Role

"Transcriptional activator MetR" in subsystem Methionine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>OLJFJH_06475 HTH-type transcriptional regulator MetR (Erwinia amylovora T8)
MIELKHLRTLQALQNTGSLAAAAAQLHQTQSALSHQFSDLEQRLGFRLFVRKSQPLRFTP
QGEVLLQLAEQVLPQIQQALQACHEPHQTTLRIAIECHSCIQWLTPALNEFRQSWPQVVM
DFKSGVTFDPQPALQQGELDVVLTSDILPRSGLFYSPMFDFEVRLVLAPNHPLAQKTVIS
PQDLASEVLMIYPVQRQRLDIWRHFLQPAGVSPALKSVDNTLLLIQMVSAGMGIAALPHW
VVESFEHQGLVVTKALGDGLWSRLYAAVRDGEQRQPVIEAFTRSARQHACEHLPRVRDAS
RPGTPLPSAYNV