Protein Info for OLJFJH_06435 in Erwinia amylovora T8

Annotation: thioesterase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 transmembrane" amino acids 60 to 78 (19 residues), see Phobius details TIGR00369: uncharacterized domain 1" amino acids 26 to 154 (129 residues), 49.7 bits, see alignment E=1.8e-17 PF13622: 4HBT_3" amino acids 56 to 153 (98 residues), 28 bits, see alignment E=2.1e-10 PF03061: 4HBT" amino acids 59 to 143 (85 residues), 39.1 bits, see alignment E=7.4e-14

Best Hits

Swiss-Prot: 71% identical to YIGI_ECOL6: Uncharacterized protein YigI (yigI) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to eay:EAM_0189)

MetaCyc: 71% identical to acyl-CoA thioesterase YigI (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]; Palmitoyl-CoA hydrolase. [EC: 3.1.2.20, 3.1.2.2]; 3.1.2.2 [EC: 3.1.2.20, 3.1.2.2]

Predicted SEED Role

"putative protein PaaI, possibly involved in aromatic compounds catabolism"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.2 or 3.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>OLJFJH_06435 thioesterase family protein (Erwinia amylovora T8)
MSALTLEPAAARRLLGKIFVYDMPFNRALGVELDRLESDFAQLSLVNQPRLVGNAAQAIL
HGGVIASVLDVAAGLVCVSGALTRQQVIYEDELRQRLARMGTIDLRVDYLRPGRGERFIA
SSSLLRGGNKISVARVELHNDAGVHIASASATYLVG