Protein Info for OLJFJH_06430 in Erwinia amylovora T8

Annotation: magnesium/cobalt transporter CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 258 to 281 (24 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 3 to 319 (317 residues), 351.4 bits, see alignment E=2.6e-109 PF01544: CorA" amino acids 29 to 315 (287 residues), 183.1 bits, see alignment E=3.8e-58

Best Hits

Swiss-Prot: 88% identical to CORA_PECAS: Magnesium transport protein CorA (corA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to eam:EAMY_0195)

MetaCyc: 85% identical to Ni2+/Co2+/Mg2+ transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-141; TRANS-RXN-141A; TRANS-RXN-141B

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>OLJFJH_06430 magnesium/cobalt transporter CorA (Erwinia amylovora T8)
MLSAFKLEKSRLTRLELDDADARDDLSDSVWVDLIEPEEAERARVQDELGQVLATSPELE
DIEASARFFEDEDGLHIHSFFFYQDAEDHAGNSTVAFTIREGRLYTLRERELPAFRLYRM
RARSQTLIDGNAYELLLDLFETKIEQLADEIETVYSDLEKLSRVIMEGKQGDEFDDALST
LAGQEDVGWKVRLCLMDTQRALNFLVRKARLPGNQLEQAREVLRDIESLLPHNESLFQKV
NFLMQAAMGFINIEQSRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSLGYPAAIV
LMILAGLAPYAYFKRKNWL