Protein Info for OLJFJH_06035 in Erwinia amylovora T8

Annotation: arsenic resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details PF01758: SBF" amino acids 50 to 224 (175 residues), 40.7 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to eam:EAMY_0126)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>OLJFJH_06035 arsenic resistance protein (Erwinia amylovora T8)
VSASAASMAARIRNGFEHHQVSIYFTAVVVASLVALVLPATTALASAINPALALMLYVTF
MQVPVTEPGKAITRLRFLLPLLLANFVIVPALVAVLIPFLPENRMLLLGVLLVLLTPCID
YVVTFSQLGRSDSRLLLASTPVLLIAQVLLLPLYLHIFLGEDASGLIKPKPFIEAFLWLI
AAPLCLAAITQRWSRRSRLGDSVCEGLGLLPVPATAVVLFIVVAAMLPRLAGVWPMALQA
VPIYVAFAVLAPLAGWMVARMFRLEPAAGRAVAFSAATRNSLVVLPLALAVPGAIPVLPA
IIITQTLVELLSELFYIRLMPQLGQMRQNQSRT