Protein Info for OLJFJH_05035 in Erwinia amylovora T8

Annotation: superoxide dismutase [Mn]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF00081: Sod_Fe_N" amino acids 2 to 88 (87 residues), 121 bits, see alignment E=2.4e-39 PF02777: Sod_Fe_C" amino acids 96 to 199 (104 residues), 140.8 bits, see alignment E=1.4e-45

Best Hits

Swiss-Prot: 88% identical to SODM_ECO57: Superoxide dismutase [Mn] (sodA) from Escherichia coli O157:H7

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to eam:EAMY_3650)

MetaCyc: 88% identical to superoxide dismutase (Mn) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Manganese superoxide dismutase (EC 1.15.1.1)" in subsystem Nitric oxide synthase or Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>OLJFJH_05035 superoxide dismutase [Mn] (Erwinia amylovora T8)
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALEGTEFANLPVEELIAKL
DQLPADKKGPLRNNAGGHANHSFFWKGLKTGTSLGGDLKAAIERDFGSVDAFKAEFEKAA
TTRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAISGASGTPIIGLDVWEHAYYLKYQNK
RPDYIKAFWDVVNWDRAAENFAAAK