Protein Info for OLJFJH_04420 in Erwinia amylovora T8

Annotation: myo-inosose-2 dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR04379: myo-inosose-2 dehydratase" amino acids 5 to 295 (291 residues), 390 bits, see alignment E=3.9e-121 PF01261: AP_endonuc_2" amino acids 37 to 294 (258 residues), 112 bits, see alignment E=2e-36

Best Hits

Swiss-Prot: 93% identical to IOLE_ERWT9: Inosose dehydratase (iolE) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03335, inosose dehydratase [EC: 4.2.1.44] (inferred from 99% identity to eam:EAMY_3504)

MetaCyc: 73% identical to myo-inosose-2 dehydratase (Klebsiella aerogenes)
Myo-inosose-2 dehydratase. [EC: 4.2.1.44]

Predicted SEED Role

"Inosose dehydratase (EC 4.2.1.44)" in subsystem Inositol catabolism (EC 4.2.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>OLJFJH_04420 myo-inosose-2 dehydratase (Erwinia amylovora T8)
MDKDKVKLAIAPIGWTNDDMPELGKENSFQQIVSEMALAGFTGSEVGSKYPRDPAVLKPM
LDIRGIEIVNAWFSTYFANGDRQKTLDEFINHRDFLHAMGAKVIGCSEQSLSIQGTSKAV
LEEKPHFSDEQWRLTVEGYNQLAKLAAERGMTVGLHHHMGTAIQTREEVDRFMAQTDDDV
CLLFDTGHAYYSEGSQQDMLAMLKQHLARINHIHLKDVRDEVVADVKAQRMSFLDGVKRG
TFTVPGDGVIDFDPVFKILDDAGYRGWMVVEAEQDPALANPFEYALKARRFIRQHAGL