Protein Info for OLJFJH_03630 in Erwinia amylovora T8

Annotation: glucose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00342: PGI
  • amino acids 52 to 540 (489 residues), 848.3 bits, E=8.6e-260

Best Hits

Swiss-Prot: 94% identical to G6PI_ERWT9: Glucose-6-phosphate isomerase (pgi) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01810, glucose-6-phosphate isomerase [EC: 5.3.1.9] (inferred from 100% identity to eay:EAM_0254)

MetaCyc: 84% identical to glucose-6-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Glucose-6-phosphate isomerase. [EC: 5.3.1.9]

Predicted SEED Role

"Glucose-6-phosphate isomerase (EC 5.3.1.9)" in subsystem Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.3.1.9)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• glycolysis I (from glucose 6-phosphate) (13/13 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• gluconeogenesis I (12/13 steps found)
• homolactic fermentation (11/12 steps found)
• heterolactic fermentation (15/18 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• Bifidobacterium shunt (12/15 steps found)
• sucrose degradation III (sucrose invertase) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• O-antigen building blocks biosynthesis (E. coli) (9/11 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• gluconeogenesis III (9/12 steps found)
• sucrose biosynthesis II (6/8 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• D-sorbitol biosynthesis I (2/3 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• 1,3-propanediol biosynthesis (engineered) (6/9 steps found)
• chitin biosynthesis (6/9 steps found)
• sucrose biosynthesis III (1/3 steps found)
• starch biosynthesis (6/10 steps found)
• formaldehyde oxidation I (3/6 steps found)
• GDP-mannose biosynthesis (1/4 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis III (2/6 steps found)
• 1,5-anhydrofructose degradation (1/5 steps found)
• colanic acid building blocks biosynthesis (5/11 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (3/14 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.9

Protein Sequence (547 amino acids)

>OLJFJH_03630 glucose-6-phosphate isomerase (Erwinia amylovora T8)
MKNTNPTKTAAWKALQQHFEQMKDVHISDLFAADANRFADFSATFDDRMLVDFSKNRITS
ETLEKLQALAKETDLQSAIKAMYSGEKINRTEDRAVLHVALRNRSNTPIVVDGKDVMPEV
NAVLAKMKAFSERIISGEWKGFTGKAITDVVNIGIGGSDLGPFMVTEALRPYKNHLKMHF
VSNVDGTHIAETLKMLSPETTLFLVASKTFTTQETMTNAHSAREWFLTSGQPRDVAKHFA
ALSTNGKAVSEFGIDTDNMFEFWDWVGGRYSMWSAIGLSIVLSIGFENFEKLLDGAHAMD
RHFADTPEEKNLPILLALIGIWYNNFFGAETEAILPYDQYMHRFAAYFQQGNMESNGKYI
DRAGNAVSYQTGPIIWGEPGTNGQHAFYQLIHQGTKLVPCDFIAPAVSHNKLSDHHSKLL
SNFFAQTEALAFGKSREAVEQEFADAGKDAKSVEHIVPYKVFEGNRPTNSILLRDITPYT
LGALVALYEHKIFTQGAILNIFSFDQWGVELGKQLASRILPELSDASEVSSHDSSTNGLI
NRYKSWR