Protein Info for OLJFJH_02585 in Erwinia amylovora T8

Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00038: translation elongation factor P
  • amino acids 4 to 187 (184 residues), 252.2 bits, E=1.3e-79
• PF08207: EFP_N
  • amino acids 5 to 61 (57 residues), 85.9 bits, E=2.2e-28
• PF01132: EFP
  • amino acids 72 to 123 (52 residues), 82.5 bits, E=2.5e-27
• PF09285: Elong-fact-P_C
  • amino acids 131 to 186 (56 residues), 91.1 bits, E=4.1e-30

Best Hits

Swiss-Prot: 98% identical to EFP_ERWT9: Elongation factor P (efp) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K02356, elongation factor P (inferred from 98% identity to ebi:EbC_04330)

MetaCyc: 87% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Protein Sequence (188 amino acids)

>OLJFJH_02585 elongation factor P (Erwinia amylovora T8)
MATYSSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRRLLTGSRVEKTFKSTD
SAEGADVVDTNLNYLYNDGEFYHFMHPETFEQHPVEAKTVGDAAKWLLDNAECIVTLWNG
KPIQVLPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRS
GEYVSRVK