Protein Info for OLJFJH_02450 in Erwinia amylovora T8
Annotation: esterase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to YJFP_ECOLI: Esterase YjfP (yjfP) from Escherichia coli (strain K12)
KEGG orthology group: K06889, (no description) (inferred from 100% identity to eam:EAMY_3146)MetaCyc: 48% identical to carboxylesterase (Escherichia coli K-12 substr. MG1655)
Carboxylesterase. [EC: 3.1.1.1]
Predicted SEED Role
"YjfP protein"
MetaCyc Pathways
- methylsalicylate degradation (2/2 steps found)
- aspartame degradation (1/2 steps found)
- methyl indole-3-acetate interconversion (1/2 steps found)
- superpathway of methylsalicylate metabolism (1/5 steps found)
- retinol biosynthesis (1/7 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.1.1.1
Use Curated BLAST to search for 3.1.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (252 amino acids)
>OLJFJH_02450 esterase (Erwinia amylovora T8) MIELNTERFAEIECLHAFPAGKRYQALPTVLFYHGYSSSKEVYAYFAVALAQAGYRAVLP DADMHGARYDGDDERRLTRFWEILRTNIDELPQIERALRQHQLVEGARLAVAGASMGGMT ALGALARYPQLHSCACLMGSGYYRQLASTLFPPRAADRAEQEKQLAEYDVSHQLARFANR PLLVWHGDADEVVPVAESVRLEQALRHSGLDRNLTYLIEKGVGHRITPPALAALKAFFAH HLPLSAGDGKAT