Protein Info for OLJFJH_02450 in Erwinia amylovora T8

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 43 to 58 (16 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details PF00756: Esterase" amino acids 27 to 143 (117 residues), 24.1 bits, see alignment E=8.7e-09 PF00561: Abhydrolase_1" amino acids 28 to 147 (120 residues), 27.7 bits, see alignment E=6.3e-10 PF12146: Hydrolase_4" amino acids 29 to 144 (116 residues), 39.4 bits, see alignment E=1.3e-13 PF01738: DLH" amino acids 41 to 214 (174 residues), 27.8 bits, see alignment E=5.7e-10 PF00326: Peptidase_S9" amino acids 94 to 229 (136 residues), 57.9 bits, see alignment E=3.1e-19

Best Hits

Swiss-Prot: 48% identical to YJFP_ECOLI: Esterase YjfP (yjfP) from Escherichia coli (strain K12)

KEGG orthology group: K06889, (no description) (inferred from 100% identity to eam:EAMY_3146)

MetaCyc: 48% identical to carboxylesterase (Escherichia coli K-12 substr. MG1655)
Carboxylesterase. [EC: 3.1.1.1]

Predicted SEED Role

"YjfP protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>OLJFJH_02450 esterase (Erwinia amylovora T8)
MIELNTERFAEIECLHAFPAGKRYQALPTVLFYHGYSSSKEVYAYFAVALAQAGYRAVLP
DADMHGARYDGDDERRLTRFWEILRTNIDELPQIERALRQHQLVEGARLAVAGASMGGMT
ALGALARYPQLHSCACLMGSGYYRQLASTLFPPRAADRAEQEKQLAEYDVSHQLARFANR
PLLVWHGDADEVVPVAESVRLEQALRHSGLDRNLTYLIEKGVGHRITPPALAALKAFFAH
HLPLSAGDGKAT