Protein Info for OLJFJH_01595 in Erwinia amylovora T8

Annotation: phosphoserine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 303 to 321 (19 residues), see Phobius details PF18429: DUF5609" amino acids 37 to 100 (64 residues), 64.2 bits, see alignment E=2e-21 TIGR00338: phosphoserine phosphatase SerB" amino acids 98 to 316 (219 residues), 282.8 bits, see alignment E=1.8e-88 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 113 to 283 (171 residues), 85.8 bits, see alignment E=3.6e-28 PF00702: Hydrolase" amino acids 114 to 283 (170 residues), 73 bits, see alignment E=1.1e-23 PF12710: HAD" amino acids 115 to 281 (167 residues), 64.3 bits, see alignment E=5.5e-21 PF05116: S6PP" amino acids 246 to 289 (44 residues), 20.5 bits, see alignment 7.8e-08 PF08282: Hydrolase_3" amino acids 248 to 312 (65 residues), 41.1 bits, see alignment E=4.6e-14

Best Hits

Swiss-Prot: 80% identical to SERB_SHIFL: Phosphoserine phosphatase (serB) from Shigella flexneri

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 100% identity to eam:EAMY_2975)

MetaCyc: 80% identical to phosphoserine phosphatase (Escherichia coli K-12 substr. MG1655)
Phosphoserine phosphatase. [EC: 3.1.3.3]

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>OLJFJH_01595 phosphoserine phosphatase (Erwinia amylovora T8)
MPNSLTWCDLPAEVSLWPGLPLSLSGDEVMPLDYRAGRSGWLLYGRQLDKARLTAYQHQL
GAAMVIVSAWAVEDYQVVRLAGSLTPLAARLAHEAGLDVAPLGRIPHLKTPGLLVMDMDS
TAIEIECIDEIARLAGSGAQVAEVTERAMRGELDFATSLRQRVATLKDADARILQTVRDE
LPLMPGLTSLVQKLQALGWHVAIASGGFTWFAEYLRDTLRLSAAVANELEIRDGKLTGEV
VGDIVDAAYKAETLRQLATRFAISPQQTVAVGDGANDLPMIKASALGIAYHAKPKVNQQS
EFIIRHADLLGVFCILSGSLIHEER