Protein Info for OLJFJH_01475 in Erwinia amylovora T8

Annotation: transaldolase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00874: transaldolase
  • amino acids 4 to 316 (313 residues), 535.3 bits, E=2.8e-165
• PF00923: TAL_FSA
  • amino acids 14 to 312 (299 residues), 323.9 bits, E=4.9e-101

Best Hits

Swiss-Prot: 88% identical to TAL_SHIDS: Transaldolase (tal) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to eay:EAM_0646)

MetaCyc: 87% identical to transaldolase B (Escherichia coli K-12 substr. MG1655)
Transaldolase. [EC: 2.2.1.2]

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• pentose phosphate pathway (8/8 steps found)
• Rubisco shunt (9/10 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.2

Use Curated BLAST to search for 2.2.1.2

Protein Sequence (317 amino acids)

>OLJFJH_01475 transaldolase B (Erwinia amylovora T8)
MTDKLSSLRQVTTVVADTGDIAAMKLYKPQDATTNPSLILSAAQIPEYRKLIDASVAWAR
DQSSNKDEQVSYAADRLAVNIGLEILKLVPGRISTEVDARLSYDTEGSIAKARSLIKLYN
DAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGAFLISPFVG
RILDWYKANTDKKEYAGNEDPGVISVSEIYQYYKQHGYETVVMGASFRNVGEIVELAGCD
RLTISPALLKELAETEGSIERKLSYSGEVKARPAKMTESEFLWQHNQDPMAVQKLAEGIR
NFAVDQSKLDKMIADLL