Protein Info for OLJFJH_00835 in Erwinia amylovora T8

Annotation: multicopper oxidase CueO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF10518: TAT_signal" amino acids 1 to 20 (20 residues), 26.1 bits, see alignment (E = 1.2e-09) TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 3 to 22 (20 residues), 19.3 bits, see alignment (E = 5.4e-08) PF07732: Cu-oxidase_3" amino acids 60 to 167 (108 residues), 97.3 bits, see alignment E=1.3e-31 PF07731: Cu-oxidase_2" amino acids 420 to 535 (116 residues), 84.7 bits, see alignment E=1e-27

Best Hits

Swiss-Prot: 64% identical to CUEO_SALTY: Blue copper oxidase CueO (cueO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K14588, blue copper oxidase (inferred from 100% identity to eay:EAM_0777)

Predicted SEED Role

"Blue copper oxidase CueO precursor" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>OLJFJH_00835 multicopper oxidase CueO (Erwinia amylovora T8)
MQRRDFIKLSAALGAAGALPVWSRALMAAEQRPLLPIPTLLIPDARSEISLTAQAINSSW
RGKRVPGWGYHANLPGPAIQLERGKEVNITLYNRLPEATTVHWHGLEVPGNVDGGPQARI
EPNHSRRVTFTPDQPAATCWFHPHLHGRTGFQVAQGLAGLVLITDPESGKLLLPKQWGID
DIPVILQDKRLSADGSRIDYKLDIMSAAVGWFGDTMLTNGAIYPQHGVPRGWLRLRLLNG
CNARSLNLTTSDKRPMYVIASDGGLLAEAVQVSELPMMPGERYEVLVDTADGKAFDLQTL
PVRQMGMTLEPFNQPLPVLSLVPLQVQASGTLPDKLVDLPAMPSSQGLNTRWLQLTMDAE
LDKRGMQALMDRYGHAAMAGISMDAHGGGKKAGANHQQMSSIDHREMTGMNHGSSAQQQK
YDFHNGNQINGMAFNMDKPSYEVKRGVYEKWTISGEGDEMLHPFHIHGTQFRILSENGKP
PAAHRSGWKDTVRVEGWRSEVLVRFNHQADRAHAYMAHCHLLEHEDSGMMLGFTVA