Protein Info for OKGIIK_16955 in Rhodanobacter sp. FW510-T8

Name: pcm
Annotation: protein-L-isoaspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF01135: PCMT" amino acids 21 to 197 (177 residues), 98.1 bits, see alignment E=1.3e-31 PF00398: RrnaAD" amino acids 67 to 122 (56 residues), 26.7 bits, see alignment E=6e-10 PF13649: Methyltransf_25" amino acids 83 to 173 (91 residues), 38.6 bits, see alignment E=2.8e-13 PF08241: Methyltransf_11" amino acids 84 to 160 (77 residues), 27.8 bits, see alignment E=6.6e-10

Best Hits

Swiss-Prot: 35% identical to PIMT_KORVE: Protein-L-isoaspartate O-methyltransferase (pcm) from Koribacter versatilis (strain Ellin345)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 52% identity to tbd:Tbd_2695)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>OKGIIK_16955 protein-L-isoaspartate O-methyltransferase (Rhodanobacter sp. FW510-T8)
MAMNIEQARLNMVENQVRPWEVLDGRVLDVLGRVRRENFVAAEHRQLAFADLCLPLGHGE
VMMKPVVEGRVLQALELLPTDSVLEIGTGSGFLTACLASLSARVSSVDIHADFTAAATRR
LQDAGIANASLATGEAVNEWQPDGLFDALVVTGAVYAIPPRWLAWLKPGARALVIRGESP
AQQATLLTHEGAGRCREETLFETDLPYLTHAEPPRRFVF