Protein Info for OKGIIK_16710 in Rhodanobacter sp. FW510-T8

Name: rlmK
Annotation: RlmI/RlmK family 23S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 19 to 67 (49 residues), 52 bits, 2e-17
• PF10672: Methyltrans_SAM
  • amino acids 175 to 349 (175 residues), 68 bits, E=3.2e-22
• PF01728: FtsJ
  • amino acids 210 to 329 (120 residues), 32.4 bits, E=3.7e-11
• PF06325: PrmA
  • amino acids 216 to 270 (55 residues), 27.4 bits, 9.6e-10
• PF05175: MTS
  • amino acids 217 to 296 (80 residues), 23.8 bits, E=1.3e-08
• PF13847: Methyltransf_31
  • amino acids 217 to 344 (128 residues), 38.7 bits, E=3.5e-13
• PF13649: Methyltransf_25
  • amino acids 221 to 297 (77 residues), 37.2 bits, E=1.6e-12

Best Hits

Swiss-Prot: 33% identical to RLMI_ENT38: Ribosomal RNA large subunit methyltransferase I (rlmI) from Enterobacter sp. (strain 638)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 59% identity to psu:Psesu_3063)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (390 amino acids)

>OKGIIK_16710 RlmI/RlmK family 23S rRNA methyltransferase (Rhodanobacter sp. FW510-T8)
MNIPAALPVIRLKSDRSPGHPWVWSAQLHKPEQKLPPGSLVAVHDAKGRFVGRAFWNGHA
RIALRLLDAHPDAGIDADWISARLARAVQLRRDWLRLDAVSDAWRVVHSEGDGLSGLIVD
RYADVLVIEYFAAGMWRFREAIHAALLAHFPDAQLYWFAESHVQKQESFDCRSPEVPAPF
EVHEHGLRFHAAPGLGHKTGFFADQRDNRKRFAELAKGRRVLDLCCNAGGFAVHAMAAGA
RAAVGVDLDAGILEVARANAAANNVAVTFEQADIFDWVRAAVARGERYDAVILDPAKLTR
DRSKVMDALKKYFAMNRMALDIIPPGGLLLTCSCTGLVGESEFLEMLRRVALNAGREIQV
LEVRGAGADHPFRTDVPEGRYLKAVFCRVD