Protein Info for OKGIIK_16625 in Rhodanobacter sp. FW510-T8

Annotation: Ferredoxin--NADP(+) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00970: FAD_binding_6
  • amino acids 7 to 105 (99 residues), 39.7 bits, E=5.2e-14
• PF00175: NAD_binding_1
  • amino acids 118 to 225 (108 residues), 63.5 bits, E=2.7e-21

Best Hits

KEGG orthology group: K03380, phenol 2-monooxygenase [EC: 1.14.13.7] (inferred from 63% identity to xal:XALc_3007)

Predicted SEED Role

"Phenol hydroxylase"

MetaCyc Pathways

• chlorinated phenols degradation (4/4 steps found)
• phenol degradation I (aerobic) (1/1 steps found)

KEGG Metabolic Maps

• Naphthalene and anthracene degradation
• Toluene and xylene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.7

Protein Sequence (248 amino acids)

>OKGIIK_16625 Ferredoxin--NADP(+) reductase (Rhodanobacter sp. FW510-T8)
MADHFQLRLVDSRMLAPAVRHLVFERVDGQPLAFQPGQFLQVHFHYDDGTATKRSYSVAT
IGDGHSPVRRIEIAVSYVEGGAATKLLGELPPGGVIDASGPYGRFCLQETDSHPRYLLLA
TGTGVTPYRAMLPQIEKLLAKGGREVVLLYGARSEAELLYGEEFEAFAQAHPGFAFHGCL
SREARAVPRPGDRLGHVQHALAELGPRADRDIAYLCGNPNMVDAAFNALKEFGLPVPQIR
REKYISSR