Protein Info for OKGIIK_16275 in Rhodanobacter sp. FW510-T8

Annotation: Diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 917 transmembrane" amino acids 52 to 72 (21 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details PF03924: CHASE" amino acids 123 to 281 (159 residues), 82.4 bits, see alignment E=7.7e-27 TIGR00229: PAS domain S-box protein" amino acids 370 to 487 (118 residues), 27 bits, see alignment E=4.1e-10 PF13188: PAS_8" amino acids 374 to 429 (56 residues), 26.3 bits, see alignment 1e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 487 to 650 (164 residues), 123 bits, see alignment E=1e-39 PF00990: GGDEF" amino acids 491 to 648 (158 residues), 135 bits, see alignment E=4.4e-43 PF00563: EAL" amino acids 670 to 909 (240 residues), 202.7 bits, see alignment E=1.2e-63

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (917 amino acids)

>OKGIIK_16275 Diguanylate cyclase (Rhodanobacter sp. FW510-T8)
MSAGAVVYHRRERHRAVTSLPGKKHPDDSLPVPPDDGGAGDQVIPQPPRWHVAAYLWGLL
ALLLGLSLALAVHEQQKQRLQAERTLVRNELANKAYVALQGRLRAAESLLRAAQSLFLSS
EEVDAGEYAGFYANMRPREQFPSLLALAYARRELRPDGEHYVTRWVEPAAGNETVVGLDV
GTQPRNLAALLASRDSDRATLSAPFHPLQLAGSGVVGEGVTLRLPIYSPGPPPRTVDERR
ARMRGSIAASFRLDGMVGNSLPDSLTRNLRLQVSDVTGPEALPLFDSGHGAVWLGDGYRY
ERKLAYGGRVWSVRMWPLPRHAGAGAGGWGRTTLWAGVLSSILLALLVYSVVSTRQRALE
LGWRMSRRYRESEERFRALNELLPALVLLAEADGGRITYANQAARARLGEHVVERRLPDL
FEDPDLRARLGSAAPRDGEWTETPLHGEAGARFWADVAISRIALDGGARLLMVASDISEQ
RRLTERLSHQASHDALTELYNRREFELRLQAALEEIGAAAPAALLYLDLDQFKLINDTSG
HLAGDQLLARLAAVMRRQLGAGDVLARLGGDEFGVLVANVADRAAAEQAAERVRRCIDGY
VFSWEQRSYQVSASIGGVLIDRPGVLVKDLLAQADTACYMAKELGRNRVHFYSERDDETV
RRHGEMEWANRLRWAVDEGRLVLAYQEIMPLPLPPVAEAGPSVELLLRFRDESGELVVPG
VFLPAAERYGLMPAVDRWVIETALAHFDQLHPAGAGLHMAAINLSGASVEDEALAGRIIG
WLRHYKVDPSRVCFEITETVAVRNLSQVVRFMEQLRAVGCRIALDDFGAGMSSFTYLKNL
PLDILKIDGSFVRDMLTDPVSHLMVRAVTDIGHRLGLQVVAEWVTDRETVQALAELGVNG
VQGFSLHRPELARFQHD