Protein Info for OKGIIK_15860 in Rhodanobacter sp. FW510-T8

Annotation: RNA pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00293: NUDIX" amino acids 7 to 135 (129 residues), 83.3 bits, see alignment E=8.4e-28

Best Hits

Swiss-Prot: 71% identical to RPPH_STRMK: RNA pyrophosphohydrolase (rppH) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 71% identity to sml:Smlt4299)

MetaCyc: 54% identical to RNA pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-; 3.6.1.-

Predicted SEED Role

"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>OKGIIK_15860 RNA pyrophosphohydrolase (Rhodanobacter sp. FW510-T8)
MIDVDGYRPNVGIVLLNADGRLFWARRVSRDGWQFPQGGMHTDETPLEAMYRELQEETGL
AAHHVEVLGATHGWLRYRLPGRYVRHHQRPICIGQKQVWFLLRLVGDEGELKLDACEKPE
FDLWRWVDFWYPAAHVVNFKRQVYERALRHFAPLVEELFGIQLGKLPPRDDADSPPTGPR
DGRAAA