Protein Info for OKGIIK_15670 in Rhodanobacter sp. FW510-T8
Name: dut
Annotation: dUTP diphosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to DUT_HAHCH: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Hahella chejuensis (strain KCTC 2396)
KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 69% identity to psu:Psesu_0156)MetaCyc: 60% identical to dUTP diphosphatase (Escherichia coli K-12 substr. MG1655)
dUTP diphosphatase. [EC: 3.6.1.23, 3.6.1.9]
Predicted SEED Role
"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)
MetaCyc Pathways
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
- dZTP biosynthesis (4/5 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
- pyrimidine deoxyribonucleotides dephosphorylation (2/3 steps found)
- tunicamycin biosynthesis (2/9 steps found)
KEGG Metabolic Maps
- Nicotinate and nicotinamide metabolism
- Pantothenate and CoA biosynthesis
- Purine metabolism
- Pyrimidine metabolism
- Riboflavin metabolism
- Starch and sucrose metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.6.1.9
Use Curated BLAST to search for 3.6.1.23 or 3.6.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (152 amino acids)
>OKGIIK_15670 dUTP diphosphatase (Rhodanobacter sp. FW510-T8) MTIDVELKILDARLGDSIPLPQAATAGSAGMDLRAALEQPLTLQPGESALVPSGIAIHIG DPGWCALVVPRSGLGHKHGLVMGNLVGVIDADYQGPLMISCWNRGSRAYTIAVGDRIAQL LLVPVAQARLNIVADFAPSARGSGGFGSTGVQ