Protein Info for OKGIIK_15410 in Rhodanobacter sp. FW510-T8

Name: ugpA
Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 72 to 94 (23 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 156 to 182 (27 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 258 to 283 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 288 (187 residues), 78 bits, see alignment E=4.1e-26

Best Hits

Swiss-Prot: 37% identical to MALF_THELN: Trehalose/maltose transport system permease protein MalF (malF) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: K10189, lactose/L-arabinose transport system permease protein (inferred from 77% identity to psu:Psesu_1285)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 1" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>OKGIIK_15410 sugar ABC transporter permease (Rhodanobacter sp. FW510-T8)
MNPPRAAWLFLAPALLVLGVFFLLPVLGALILSLTDYDLYALADLHNLRFVALGNYWELL
QRPLFWSALGHTVYFVAAGVPLSMGASLGAALLLNSPLARCKPLFRTALFTPVVTTVVAV
AVIWRYLFNTRYGMANHVLGLAGIHPVDWLGDPHWAMPTIILFAVWKNFGYNMIIFLAGL
QAIPPELYEAARIDGASNWRQFRHITLPMLGPTLLMVGILTVSGYFQLFAEPYVMTEGGP
LQSTVSVLYLMYDEGFKWWNLGSASAVAFLLFVIMFAVTALMLRLVRRGEHPDGGPA