Protein Info for OKGIIK_15265 in Rhodanobacter sp. FW510-T8

Name: dnaA
Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF11638: DnaA_N" amino acids 3 to 63 (61 residues), 44 bits, see alignment E=3.8e-15 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 5 to 442 (438 residues), 558.1 bits, see alignment E=8e-172 PF00308: Bac_DnaA" amino acids 109 to 269 (161 residues), 231.7 bits, see alignment E=1.3e-72 PF00004: AAA" amino acids 145 to 262 (118 residues), 26.7 bits, see alignment E=1.7e-09 PF01695: IstB_IS21" amino acids 145 to 246 (102 residues), 26.8 bits, see alignment E=8.7e-10 PF08299: Bac_DnaA_C" amino acids 355 to 421 (67 residues), 103.9 bits, see alignment E=9.2e-34

Best Hits

Swiss-Prot: 67% identical to DNAA_STRMK: Chromosomal replication initiator protein DnaA (dnaA) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 66% identity to psu:Psesu_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>OKGIIK_15265 chromosomal replication initiator protein DnaA (Rhodanobacter sp. FW510-T8)
MSDLWRRCLERLEGELSAEDLHTWLMPLQAREDADGLQLFAPNPYTLDTVRERYLERIGA
VLQQLGGKPCPVRLEVGSNSPRPAPTARPAAAPAARLASAPAPAFSHNLDPHYTFETFVE
GKSNQLGKAAAMQVATNPGRAYNPLLLYGGTGLGKTHLMHAAGNLMRERNPDCKVLYLRS
EQFVGSMIEALRAKSMDQFKQRFRSVDALLIDDIQFFAGKDTTQEEFFHTFNALFESKQQ
IILTCDRYPKEVDKLEPRLKSRLGWGLSVAIEPPDFETRAAILLAKAHDKGVAVDEHVAM
LLAKRIRSNVRDLEGALNTLAARANFYGKPITTDFAEETLRDLLATHAQAITIPNIQKIT
AEYFNVRLQDLLSKRRVRSLARPRQIAMTLSKELTEHSLPEIGEAFGGRDHTTVMHACKT
IRKFIETDARMRQDWEQLIRTLTG