Protein Info for OKGIIK_14870 in Rhodanobacter sp. FW510-T8

Name: doxX
Annotation: Uncharacterized membrane protein YphA, DoxX/SURF4 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details PF07291: MauE" amino acids 5 to 80 (76 residues), 29.4 bits, see alignment E=1.3e-10 PF07681: DoxX" amino acids 7 to 86 (80 residues), 76.3 bits, see alignment E=3.6e-25

Best Hits

Swiss-Prot: 48% identical to YQJF_ECOLI: Inner membrane protein YqjF (yqjF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 51% identity to aci:ACIAD0149)

Predicted SEED Role

"Inner membrane protein YqjF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>OKGIIK_14870 Uncharacterized membrane protein YphA, DoxX/SURF4 family (Rhodanobacter sp. FW510-T8)
VDKLISVVARLLMAQLFIISGWQKLTGFSGTEGYLASMGIPMVGLVTPLVILIELGGGLA
LLFGFKTRWVAAVIALFSVGSALVAHTHFADQAQAINFMKNLSIAGGLLWFVRNGGGTAS
VDAQIGSK