Protein Info for OKGIIK_14700 in Rhodanobacter sp. FW510-T8

Annotation: Hexosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13579: Glyco_trans_4_4
  • amino acids 23 to 168 (146 residues), 43.9 bits, E=8e-15
• PF13439: Glyco_transf_4
  • amino acids 23 to 174 (152 residues), 44.5 bits, E=4.6e-15
• PF20706: GT4-conflict
  • amino acids 154 to 293 (140 residues), 36 bits, E=1e-12
• PF00534: Glycos_transf_1
  • amino acids 187 to 340 (154 residues), 100.3 bits, E=2.3e-32
• PF13692: Glyco_trans_1_4
  • amino acids 191 to 329 (139 residues), 87.9 bits, E=1.9e-28

Best Hits

KEGG orthology group: None (inferred from 72% identity to xop:PXO_00194)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (368 amino acids)

>OKGIIK_14700 Hexosyltransferase (Rhodanobacter sp. FW510-T8)
MKLALVVPGGVDRSGEFRVIPVLLALIGRLARAHDVHVFALRQEAAAGRWQLAGATVHNI
GDGWTRLRAIAAIRAEHRRAPFDVIQAIFSGSCSLVAVAAAKWLRRPSLVHVAGGELVTL
YAIGYGGRRKWKGRLREAVVLRGADVITAASAPIIDSLQTLGLKARRVPLGVDLRTWPPL
APRERSAKQARLIHVASLNRVKDQSTLLQALAVLAEAGLDFRMDIVGEDTLQGEMQQLAR
RLGLEQHVRFHGFKTQRELRPLMESADLLVMSSLHEAGPLVALEAAAAGVPTVGTAVGHI
AEWAPSAALAVPIGEAPALADAIRRLLGDEELRLRLAATAQCRAIREDADHTALAFEAIY
LRLLAACE