Protein Info for OKGIIK_14455 in Rhodanobacter sp. FW510-T8

Name: gnd
Annotation: decarboxylating 6-phosphogluconate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00872: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 1 to 300 (300 residues), 386 bits, see alignment E=5.9e-120 PF03807: F420_oxidored" amino acids 3 to 92 (90 residues), 22.2 bits, see alignment E=3.5e-08 PF03446: NAD_binding_2" amino acids 3 to 153 (151 residues), 141.8 bits, see alignment E=4.1e-45 PF00393: 6PGD" amino acids 169 to 279 (111 residues), 75.4 bits, see alignment E=1e-24

Best Hits

Swiss-Prot: 44% identical to YQEC_BACSU: Putative 6-phosphogluconate dehydrogenase YqeC (yqeC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 74% identity to xcv:XCV0741)

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>OKGIIK_14455 decarboxylating 6-phosphogluconate dehydrogenase (Rhodanobacter sp. FW510-T8)
MELGMVGLGRMGANMAERLVKGGHKVAGFDPSAEARQAAAANGIAPATSLAALVEALPAP
RAVWLMVPAGKITDDTVEALLPLLAKGDTVIDGGNSNYKDSLRRAQLYAERGLGYVDCGT
SGGVWGLKEGYSMMIGGDEKTVEALRPIFETLAPAKDQGWGRVGPAGSGHYTKMVHNGIE
YGMMQAYAEGFSILKHKEEFGLDLHQVGEIWRTGSVVRSWLLDLATDALGKNPNLDGIAP
YVVDSGEGRWTVNAALELNVSAPVITLSLMERFRSRDSDSFADKLLASLRNEFGGHAVKK
E