Protein Info for OKGIIK_14220 in Rhodanobacter sp. FW510-T8

Annotation: HGSNAT-cat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details amino acids 324 to 342 (19 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 4 to 149 (146 residues), 44.5 bits, see alignment E=1.4e-15 PF16401: DUF5009" amino acids 5 to 131 (127 residues), 31.4 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: None (inferred from 59% identity to psu:Psesu_0212)

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>OKGIIK_14220 HGSNAT-cat domain-containing protein (Rhodanobacter sp. FW510-T8)
MNGRLASLDALRGCTVAAMLLVNDPGDWSHVYWPLEHASWNGCTPTDLVFPFFLFVLGVS
VALAILPRLEQGVAPSALRNAALWRALRILALGVLINALAAWWLPGSDMRWPGVLQRIGA
CFAAVAMLAIYAPRRVWWVAIVALLVGYTVILLSGGTLEKWINIADRVDGAVFGHYAWER
NAITGQVHDPEGLLSTLGAIASSLLGLCAGCWLRAGQTRRLLLAGLLALLLGASWSPWLP
FNKNLWTPSFVLWTTGWATLALLAFHALIDRRGWPAWGRRFGINAIAAYAGSELMQILLP
ALGWQPPIYRHLFAGWMTPRFGPYLPSLAFAAAFVALWWLIVRAMDWRGIHLKL