Protein Info for OKGIIK_13895 in Rhodanobacter sp. FW510-T8

Annotation: DUF2182 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 205 to 233 (29 residues), see Phobius details PF09948: DUF2182" amino acids 35 to 218 (184 residues), 142.6 bits, see alignment E=7.3e-46

Best Hits

KEGG orthology group: None (inferred from 57% identity to reh:H16_B0829)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>OKGIIK_13895 DUF2182 domain-containing protein (Rhodanobacter sp. FW510-T8)
MPAVGTLPMPGGWALSMAWMRMCGQTWSGAVASFLGMWVVMMAAMMLPSLLPVLWRYRRA
IGDGGTGPYRQVALLGAGYFAAWSALGLAVYPPGVALAALAMRLPVWARAVPVATGVVVL
AAGALQFSAWKARRLARCREEMPGRGRPLPAGAGIAWRHGLRCICSCANLTALLLAIGIM
DLRAMAAVTVAITLERVAPAGWCVARAIGAVAVGAGLVLIAQAAMPILPAIGGLVFH