Protein Info for OKGIIK_13790 in Rhodanobacter sp. FW510-T8

Name: rsmB
Annotation: 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF01029: NusB" amino acids 4 to 126 (123 residues), 61 bits, see alignment E=2.4e-20 TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase" amino acids 6 to 432 (427 residues), 318.8 bits, see alignment E=3.3e-99 PF22458: RsmF-B_ferredox" amino acids 145 to 218 (74 residues), 83 bits, see alignment E=2e-27 PF01189: Methyltr_RsmB-F" amino acids 244 to 430 (187 residues), 176 bits, see alignment E=1.2e-55

Best Hits

Swiss-Prot: 47% identical to RSMB_PSEPK: Ribosomal RNA small subunit methyltransferase B (rsmB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 47% identity to tcy:Thicy_1521)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>OKGIIK_13790 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB (Rhodanobacter sp. FW510-T8)
MKTDTRALAAKGLAEVALRGASLRDVMERSAPRLADPRDRALLMALLSEGARWWLRFDPA
VDGLLEKSLRPKDPAVHALLVLGLVQLEILQLQDYAAVAATVEAVRALKRPQLAGLVNAV
LRRWQRERASLLAKLDATPQTRHAHPAWLAAALRRDWPQQAEAVMAADNGEPPLMLRVNR
RRSGREALIARLQAAGYAATAHPWLDDALVLPHSTDVTRMPGFDDGLFAVQDGAAQVAAD
LAELRDGLRVLDACAAPGGKACHLLERADIELTALEFDAARVERIRQNLMRLRLDAKVVA
GDAGAPKGWWSGRPFDRILIDAPCSASGVLRRRPDVRLHRRESDIAAMQTQQRRILAALW
PLLAPGGRLVYITCSVLRAENEAIVGELLATQADAQAVAFTLPAGQPAAVGWQILPGDGD
LDGMYYAVLQKRD