Protein Info for OKGIIK_13365 in Rhodanobacter sp. FW510-T8

Annotation: Peptidase M56

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details PF05569: Peptidase_M56" amino acids 15 to 301 (287 residues), 171.5 bits, see alignment E=1.3e-54

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (611 amino acids)

>OKGIIK_13365 Peptidase M56 (Rhodanobacter sp. FW510-T8)
MDALGHFADTLLTRLLWTSIQASLLIGIVYLLGCLWPRLSAAMRCMLWWLVGAQLLLGLL
WHAPLELPLLSPTPFEATAPVTPPMTFFAAAAGDVALPSLASPPTHALSWRTGIALSWLA
VLLLQGLVALRQWRQARSVLRESRPLRDASLQALCARQARQLGLRRCPRLRVSGAIVSPQ
VTGLWRPTVLLPAGHALSADEAAMAIAHELAHLRRGDLWLAWVPALAQCLFCFHPLVRWA
MREYALNRESACDAQVLRHDRAAPQEYGRLLLRLGVAQPMHAGLAGASPSFHNLKRRLTM
LQQTVNQPPSRIRGWLLVAVIALVGVLPYRVTAAGADNTQATPASTQASLLPPPPAPPAV
PPPTVPALPPAPPAPPLPPTPPHDANGLRVHYANVAIHTDASEGFALFDGDAAIVNGSDA
DLAAAKRLQRNGKSMLWFRRGDKAWLIDDPAYVQRAKAAYAPVDALARQQGELGGKQGAL
GGKQGALGAQQGMLGAQQGQLAGQRAMLANQQAMLAAQSGQRDHTAEMQANRAKLEVSEQ
ELNRQQEKLSQQQEELGRQQTEIGKQQEALGAQQEALGKRQQQATSQASQQIRKLLDEAI
AKGVAKPTSLR