Protein Info for OKGIIK_13330 in Rhodanobacter sp. FW510-T8

Name: yifB
Annotation: YifB family Mg chelatase-like AAA ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 TIGR00368: Mg chelatase-like protein" amino acids 8 to 495 (488 residues), 631.5 bits, see alignment E=4.8e-194 PF13541: ChlI" amino acids 21 to 142 (122 residues), 145.9 bits, see alignment E=1.6e-46 PF01078: Mg_chelatase" amino acids 190 to 391 (202 residues), 322.6 bits, see alignment E=2.6e-100 PF00493: MCM" amino acids 288 to 383 (96 residues), 30.7 bits, see alignment E=5.3e-11 PF13335: Mg_chelatase_C" amino acids 403 to 495 (93 residues), 98.7 bits, see alignment E=7.3e-32

Best Hits

Swiss-Prot: 54% identical to COMM_HAEIN: Competence protein ComM (comM) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>OKGIIK_13330 YifB family Mg chelatase-like AAA ATPase (Rhodanobacter sp. FW510-T8)
MSLAVTLSRAQEGIAAPQVMVEVHLSGGLPSTSIVGLPEAAVREARDRVRVAIQNTAFEY
PGRRVTVNLAPAELPKDGGRFDLPIALGILAASGQVPREKLDDCEFLGELALTGSLRGVS
GVLPALLRARARGRRVVVPRANANEAALVSDMDVRVADTLAEVCGWLRGAHELLMPVGIP
SDGGADGGPDLADVRGQLQARRALEITAVGGHHLLLVGPPGTGKTMLAERLPGILPPLSE
SEALETCAVLSVAGQVTDPKHWRRRPFRAPHHTASAVALVGGGSSPRPGEISLAHNGVLF
LDELPEFSRHVLEVLREPMESGHIMISRAARRSMFPAQFQLVAAMNPCPCGYAGNPRCQC
TPDQIQRYRARISGPLLDRIDLCVEVPPVPLADLGTPRGERDEDSATVRARVLKARHQSL
MRAGRPNAEISTRELERDCALGPAERRWFEAALERLGLSARAYHRVLRVARTIADLDGGA
ALLEREHLAEALQYRRF