Protein Info for OKGIIK_13320 in Rhodanobacter sp. FW510-T8

Name: aceA
Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01346: isocitrate lyase
  • amino acids 8 to 247 (240 residues), 354.9 bits, E=3.3e-110
  • amino acids 248 to 424 (177 residues), 280.6 bits, E=1e-87
• PF00463: ICL
  • amino acids 13 to 247 (235 residues), 192.7 bits, E=1e-60
  • amino acids 249 to 424 (176 residues), 160.1 bits, E=7.6e-51
• PF13714: PEP_mutase
  • amino acids 74 to 272 (199 residues), 57.4 bits, E=1.7e-19

Best Hits

Swiss-Prot: 72% identical to ACEA_BACHD: Isocitrate lyase (aceA) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 88% identity to sml:Smlt0232)

MetaCyc: 68% identical to isocitrate lyase subunit (Mycobacterium tuberculosis H37Rv)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Protein Sequence (429 amino acids)

>OKGIIK_13320 isocitrate lyase (Rhodanobacter sp. FW510-T8)
MKTLPTAEQITLDWNNNPRWTGVQRNYSAEDVVRLRGTVAVEHSLARRGAERLWKSLHQE
DFVNALGALTGNQAMQQVKAGLQAIYLSGWQVAADANVAGEMYPDQSLYPANSVPLVVKR
INNTLLRADQLHHAEGKDDCDWLVPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQ
LASVKKCGHMGGKVLVPTREAVDKLNAARLAADVAGVPTLLVARTDADAADLLTSDIDAN
DRPFITGERTVEGFFRVRPGLDQAISRGLAYAPYADLIWCETSKPNLDDARRFAEAIHAK
FPGKMLAYNCSPSFNWKKNLDDATIANFQKELGAMGYKFQFITLAGFHSLNYGMFDLAHG
YARRQMSAFVELQEKEFAAAERGFTAVKHQREVGTGYFDQVTQAIQQGQSSTTALKGSTE
EAQFRQAVA