Protein Info for OKGIIK_13290 in Rhodanobacter sp. FW510-T8

Name: wcaG
Annotation: nucleoside-diphosphate sugar epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 3 to 238 (236 residues), 164.3 bits, E=8.2e-52
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 314 (311 residues), 147.5 bits, E=1.7e-46
• PF01073: 3Beta_HSD
  • amino acids 4 to 236 (233 residues), 32.1 bits, E=1.6e-11
• PF07993: NAD_binding_4
  • amino acids 64 to 189 (126 residues), 24.7 bits, E=3e-09

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 52% identity to llo:LLO_0382)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• dTDP-3-acetamido-α-D-fucose biosynthesis (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
• dTDP-β-D-fucofuranose biosynthesis (2/4 steps found)
• dTDP-6-deoxy-α-D-allose biosynthesis (2/4 steps found)
• dTDP-N-acetylthomosamine biosynthesis (2/4 steps found)
• dTDP-N-acetylviosamine biosynthesis (2/4 steps found)
• D-galactose detoxification (1/3 steps found)
• dTDP-L-daunosamine biosynthesis (3/6 steps found)
• dTDP-sibirosamine biosynthesis (3/6 steps found)
• dTDP-α-D-mycaminose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (2/5 steps found)
• dTDP-β-L-digitoxose biosynthesis (3/7 steps found)
• dTDP-β-L-olivose biosynthesis (3/7 steps found)
• dTDP-D-desosamine biosynthesis (2/6 steps found)
• dTDP-β-L-4-epi-vancosamine biosynthesis (3/8 steps found)
• dTDP-β-L-megosamine biosynthesis (3/8 steps found)
• dTDP-β-L-mycarose biosynthesis (2/7 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• dTDP-α-D-forosamine biosynthesis (3/9 steps found)
• dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (3/9 steps found)
• superpathway of enterobacterial common antigen biosynthesis (3/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• superpathway of novobiocin biosynthesis (4/19 steps found)
• superpathway of erythromycin biosynthesis (2/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
• superpathway of megalomicin A biosynthesis (3/22 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (3/23 steps found)

KEGG Metabolic Maps

• Biosynthesis of vancomycin group antibiotics
• Galactose metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46, 5.1.3.2

Use Curated BLAST to search for 4.2.1.46 or 5.1.3.2

Protein Sequence (338 amino acids)

>OKGIIK_13290 nucleoside-diphosphate sugar epimerase (Rhodanobacter sp. FW510-T8)
MHVLITGGAGFIGSHLVALHLAQGHKVHVVDDLSTGLRSNLAPFEASPSFRFDEADMLTW
PLLQQAAAWADRVYHLAAVVGVYRVIAEPTRVLATNIAACERLFRTIAASGWRPQVVVAS
SSEVYGHRHAELLGEDMDLSVSTRAGTRWNYSVSKIADEALALSYAQKFGIPVLVARFFN
TIGPRQTGRYGMVVPRFVDQAVHGEPITVYGDGKQTRSFCDVRDNVAALDLLASRESGDA
LVANVGNDREISMNALAELVRERADSDSPITHVPYMKAYGEDFEDIQRRRPELTRLRMLT
GFRHRYTLEDTLDELIQERRNALAGTEHGHRTLVCHQS