Protein Info for OKGIIK_12545 in Rhodanobacter sp. FW510-T8

Annotation: Amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 417 to 434 (18 residues), see Phobius details PF13520: AA_permease_2" amino acids 13 to 415 (403 residues), 195.3 bits, see alignment E=1.8e-61 PF00324: AA_permease" amino acids 18 to 375 (358 residues), 97.3 bits, see alignment E=8.9e-32

Best Hits

KEGG orthology group: None (inferred from 46% identity to gau:GAU_2215)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>OKGIIK_12545 Amino acid permease (Rhodanobacter sp. FW510-T8)
MPIEPANAYARRLNTWDAAMIVIGGVIGAGIFITPATVAQNTSSGMQVLALWAIGGLLTL
AGVLCYGELGARRPQAGGIYVYLREAFGLLPAFLFGWTMALINYPGSVAAVVTKFAVYFC
RALGLSRLYEMPVAVGAIVFIVSINLFGIRAGAWMQNIFTVLKVLAIALLVVAGLVLAQG
QFGVALAPDTTHPVSPWAFAGALLPVLFAYGGFHYLNDLAGEVRDPQRTLPRALGMGMAG
VVLCYVLVNFAYLAGLGHAGLATSIAPAADLMQKLFGAHGATVIEVGIACSTFGYCSIAI
AGGARVLQTMGADGVFFRATGRVDPRTRAPQIALAVLGAWAIVLTVSGSFNQLLNYTTVG
EWLGHVFGIGTLFWYRKHFIDDPAPYRVPFYPLLPLVFVITVFGVIVASAIHAPGDAGMS
LLIIALGVPVYYGWQRWTRNRPA